PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000193637
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 205aa    MW: 23663 Da    PI: 5.3098
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000193637genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d++ ++G+g W+++ +  g++R++k+c++rw +yl
    MDP0000193637  9 KGLWTVEEDKILTDYIXLHGKGKWNRVNKVSGLKRSGKSCRLRWMNYL 56
                     678*******************************************97 PP

2Myb_DNA-binding56.56.4e-1862106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r  +++eEd+l+++++++lG++ W++Ia +++ gRt++q+k++w+ +
    MDP0000193637  62 RSDFSEEEDDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNGH 106
                      6789******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.579456IPR017930Myb domain
SuperFamilySSF466892.93E-307103IPR009057Homeodomain-like
SMARTSM007171.4E-12858IPR001005SANT/Myb domain
PfamPF002496.3E-14956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-211063IPR009057Homeodomain-like
CDDcd001678.64E-101256No hitNo description
PROSITE profilePS5129427.39857111IPR017930Myb domain
SMARTSM007171.4E-1661109IPR001005SANT/Myb domain
PfamPF002491.8E-1662106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2564111IPR009057Homeodomain-like
CDDcd001672.34E-1265107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGGGNEYKKG LWTVEEDKIL TDYIXLHGKG KWNRVNKVSG LKRSGKSCRL RWMNYLSPSV  60
KRSDFSEEED DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NHWNGHLSKK LESNSELQPL  120
PNSDSNSKIF GDHEAAAAID EFDDEMMNIQ DHIGSTSEVG FSGMWEATMM SNDKFWFHSD  180
DLNQYSPYLW DPTLDDHYPF QFDNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2891137110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.139891e-152fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360811.11e-145PREDICTED: transcription factor WER-like
RefseqXP_008393035.11e-145PREDICTED: transcription factor WER-like
SwissprotQ9SEI02e-61WER_ARATH; Transcription factor WER
TrEMBLM5WAK51e-104M5WAK5_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g08480.t012e-65(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-62myb domain protein 66